PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_66.60
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GRAS
Protein Properties Length: 289aa    MW: 33222.4 Da    PI: 6.905
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_66.60genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS148.85.2e-46902731184
                         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalk 82 
                                  l++lLl  A+av+++++  + + L++l + +s +gd++qR++ayf  +Laarl+   s  y+ +   +ts    +e++ +++
  evm.model.supercontig_66.60  90 LIRLLLLTATAVDENNADSVMRNLTELYQAVSLTGDSVQRVVAYFSDGLAARLLTRKSPFYDMILKDPTS----EEQFLSFT 167
                                  57899**************************************************999***999888885....78888889 PP

                         GRAS  83 lfsevsPilkfshltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskee 157
                                  +++ +sP+++f+h+taNqaI ea+++e     +++H+iD+d+s+G+QWp+L+q+L++++  +++  lRiTg+g+    s ee
  evm.model.supercontig_66.60 168 YLYRASPYYQFAHFTANQAIFEAFNKEqddnnRALHVIDLDVSYGFQWPSLIQSLSEKAtsANKIYLRITGFGR----SIEE 245
                                  *************************9988887889***********************95445559********....9*** PP

                         GRAS 158 leetgerLakfAeel.gvpfefnvlvak 184
                                  l+et+ rL +f + + ++ fef+ l+++
  evm.model.supercontig_66.60 246 LQETETRLVSFSKGFhNLVFEFRGLLTS 273
                                  ************987579****998655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098531.03464288IPR005202Transcription factor GRAS
PfamPF035141.8E-4390273IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MENHMVADQD VDDDHDQEEL LNLSLAIVTD HDQKRRSKKK RRVVFSTSSA ADQEEGKVFK  60
LLQTREQMLK KILIDQTRKQ HDDRYGGLRL IRLLLLTATA VDENNADSVM RNLTELYQAV  120
SLTGDSVQRV VAYFSDGLAA RLLTRKSPFY DMILKDPTSE EQFLSFTYLY RASPYYQFAH  180
FTANQAIFEA FNKEQDDNNR ALHVIDLDVS YGFQWPSLIQ SLSEKATSAN KIYLRITGFG  240
RSIEELQETE TRLVSFSKGF HNLVFEFRGL LTSPSSPFQT PRSKKKEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-14952718184GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13440RRSKKKR
23741KKKRR
33742KKKRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007199010.11e-123hypothetical protein PRUPE_ppa017519mg
TrEMBLM5VGL51e-123M5VGL5_PRUPE; Uncharacterized protein
STRINGGLYMA10G35920.21e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15761916
Representative plantOGRP81961117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.15e-27GRAS family protein