PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_654.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 401aa    MW: 44223.6 Da    PI: 4.4341
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_654.7genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.73.6e-142061243
                                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                                 + en+   qvtfsk r  ++KKA+EL++LC  +v  iifs+ 
  evm.model.supercontig_654.7 20 KMENEASLQVTFSKHRSSLFKKASELCTLCRPDVGHIIFSPG 61
                                 6799999********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.4E-171170IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.7831171IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.97E-191392IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-121333IPR002100Transcription factor, MADS-box
PfamPF003191.0E-162065IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-123348IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-124869IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MADEGTSSKS KSRQKIESKK MENEASLQVT FSKHRSSLFK KASELCTLCR PDVGHIIFSP  60
GDRAFCHGNP NIDIVIDRFL SIDVRPARDP HNDNDTQQTI SRITEAQDKE EAARKRGKEL  120
KQRRKGLMKE LWYTRSMDKF NLEELEVLDA GMKALWNDVV ELAKKLKKEQ GNSSSAEGSP  180
RDDGMFYSDP AIKGLTTFPM PSMPSNPTHE YAPSSINSTP PLSSFCNLDS GNPNIMMMDN  240
PLNDSSMALD PVDDLKAMPR DLFNNLVMIE SDDPIASLNA GDNPDIIFDA FGNQIVTMDI  300
NLSNDPNIGL NEFFNPSTMP HAPNDPISTA SDALNMIRIV PDDSNLDSVF DGFTLVMLFA  360
DPLDDENFIV DNPNEAANSD NPKKMPPPFA GNVLGNGQGF *
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_654.7
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ4103950.0KJ410395.1 Carica papaya sex-specific marker RX15_10 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021911410.10.0agamous-like MADS-box protein AGL62
STRINGevm.model.supercontig_654.70.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.15e-31AGAMOUS-like 62