PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_65.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 439aa    MW: 48692.7 Da    PI: 9.6259
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_65.5genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.61.8e-18231265135
                        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                 C +C +tkTp+WR+gp g+ktLCnaCG++yr+ +l
  evm.model.supercontig_65.5 231 CMHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRL 265
                                 99*****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.701225261IPR000679Zinc finger, GATA-type
SMARTSM004011.3E-17225279IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.28E-14228288No hitNo description
Gene3DG3DSA:3.30.50.103.3E-14229262IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.74E-13230277No hitNo description
PROSITE patternPS003440231256IPR000679Zinc finger, GATA-type
PfamPF003202.3E-16231265IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MNSSWFFDEN FNGLSDDFFD DVVKCFDFPL EDVELNNGED WDAGFQNLEP PPANVLAGLS  60
SDLSDNTCKQ NVGVQQSRPM PFQYSGTSEV KQHPSTYGAP SSRSIFIHKS TNGKDSRLLQ  120
TSSPVSVLEN SSSSSAENPA SLNTKLSIPV KRTRSKRRRP SASYLQSTFR FISSVTASGE  180
SHATVESESE SCLAEKSSKK KQKKKRNLTL LSGSGETKKS LPDQSVPTRK CMHCEVTKTP  240
QWREGPMGPK TLCNACGVRY RSGRLLPEYR PAASPTFVPS LHSNSHKKVI EMRKKTEQLP  300
SKSVTYTVTP ENSHECLLLR RLCSRMKSNR LKCGKARGER GNVGEVPNGP RYEVFDSEIC  360
WNHEEGNVCF LRATRSSNLM DQQSGQLRGC YLSESGRRDG AALFRLSLNL SKLSWLPQDN  420
FLAASGRLAQ TAKIKNHS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151156RTRSKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_65.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021896249.10.0GATA transcription factor 11-like
TrEMBLA0A2P2LDR06e-98A0A2P2LDR0_RHIMU; Uncharacterized protein
STRINGevm.model.supercontig_65.50.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.22e-50GATA transcription factor 11