PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_65.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family TCP
Protein Properties Length: 186aa    MW: 19689.3 Da    PI: 11.4784
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_65.20genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP80.15.7e-251669457
                          TCP  4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakp 57
                                  + r +++h kv+gRdRRvRl+a caar+F+L++eLG+ +d++t+eWLl+  + 
  evm.model.supercontig_65.20 16 TQPRRKDRHLKVDGRDRRVRLPAVCAARIFQLTRELGLASDGQTVEWLLRHFQN 69
                                 67899********************************************97653 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-202067IPR005333Transcription factor, TCP
PROSITE profilePS5136920.422074IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MPNRPTKTKP TTKRATQPRR KDRHLKVDGR DRRVRLPAVC AARIFQLTRE LGLASDGQTV  60
EWLLRHFQNT RFPSSVSSTS TQIPSGSASA TPASISFNVP AQATVSPAIG STSGSVDSPS  120
FGGLNLTMGI TRSPSVEINS REINNGGSGG SLGLLPGGDM SFTSLPTKVE EKADKGTMIF  180
GCRLF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_65.20
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021896119.11e-132transcription factor TCP21-like
STRINGevm.model.supercontig_65.201e-131(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9221459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.12e-20TCP family protein