PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_65.19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family TCP
Protein Properties Length: 120aa    MW: 12853.3 Da    PI: 10.1015
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_65.19genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP54.44.9e-17668365
                          TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt 65
                                 +  +r  ++hT v+ R+  v l+aeca r+F L+ eLG+ + ++t+eWLl+q  +a  +++ +
  evm.model.supercontig_65.19  6 TTNSRRRDRHTRVEDRGHFVTLPAECADRIFRLTGELGLQSHGQTVEWLLRQGLAARFAMPVS 68
                                 567899**********************************************98888777777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.4E-131061IPR005333Transcription factor, TCP
PROSITE profilePS5136913.9861165IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MSNRTTTNSR RRDRHTRVED RGHFVTLPAE CADRIFRLTG ELGLQSHGQT VEWLLRQGLA  60
ARFAMPVSFA SNQTPSGAAP AVAPATGFAP GSVDPPSSGG RSVEINNGGM MEEDGRRLF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_65.19
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021896118.19e-83transcription factor PCF2-like
STRINGevm.model.supercontig_65.193e-82(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9221459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.12e-09TCP family protein