PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_65.17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family TCP
Protein Properties Length: 159aa    MW: 17432.8 Da    PI: 9.4376
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_65.17genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP92.39.9e-292691570
                          TCP  5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70
                                 k +++++h+kv+gRdRRvR++a+caar+F+L++eL f++++ ti WLl q++ +i++ tg + s+a
  evm.model.supercontig_65.17 26 KPKTKDRHAKVEGRDRRVRIPADCAARVFQLTRELSFKTNGDTIRWLLYQSESSIIARTGYGVSPA 91
                                 789*********************************************************977776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.2E-242885IPR005333Transcription factor, TCP
PROSITE profilePS5136922.4182983IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MSSNMNATNL DGADQPISKK PTGLPKPKTK DRHAKVEGRD RRVRIPADCA ARVFQLTREL  60
SFKTNGDTIR WLLYQSESSI IARTGYGVSP APPPPPPPPS PVVELFPGGS SFNPPAFQVY  120
RPVPLLPSPE FNHFMASYDL PYHFTGTHGI DMFEAAEK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016815.12e-26Transcription factor-like protein
SwissprotQ9LT891e-26TCP19_ARATH; Transcription factor TCP19
TrEMBLA0A061H0A32e-26A0A061H0A3_THECC; Transcription factor-like protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9221459
MalvidsOGEM157501016
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.11e-23TCP family protein