PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_65.141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HD-ZIP
Protein Properties Length: 188aa    MW: 21211.1 Da    PI: 8.6063
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_65.141genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-194296256
                                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                  rk+ ++tkeq + Lee F++n++++ +++e LA++l+L  rqV vWFqNrRa+ k
  evm.model.supercontig_65.141 42 RKKLRLTKEQSRLLEESFRQNHTLNPKQKETLATQLKLRPRQVEVWFQNRRARSK 96
                                  78889************************************************98 PP

2HD-ZIP_I/II119.71.6e-3842130189
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rl+keq++lLEesF+++++L+p++K++la++L+l+prqv+vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+n+rL+
  evm.model.supercontig_65.141  42 RKKLRLTKEQSRLLEESFRQNHTLNPKQKETLATQLKLRPRQVEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEQNRRLQ 122
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLre 89 
                                   +eveeLr+
  evm.model.supercontig_65.141 123 REVEELRA 130
                                   ******94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-183092IPR009057Homeodomain-like
SuperFamilySSF466893.08E-193399IPR009057Homeodomain-like
PROSITE profilePS5007117.3943898IPR001356Homeobox domain
SMARTSM003891.7E-1740102IPR001356Homeobox domain
CDDcd000862.83E-164199No hitNo description
PfamPF000467.0E-174296IPR001356Homeobox domain
PROSITE patternPS0002707396IPR017970Homeobox, conserved site
PfamPF021835.4E-1098132IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.4E-2298141IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MKGDYCAVKE LDINQVPSGE EEWTAGATVE EEEESSNGGP PRKKLRLTKE QSRLLEESFR  60
QNHTLNPKQK ETLATQLKLR PRQVEVWFQN RRARSKLKQT EMECEYLKRW FGSLTEQNRR  120
LQREVEELRA MKVGPPTVIS PHSCEPLPAS TLTMCPRCER VTSTAPTAVL DTTAKAGPPR  180
QSSSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19098RRARSKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_65.141
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021896220.11e-128homeobox-leucine zipper protein HOX3
SwissprotQ0JKX12e-81HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH382e-81HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A0L9VAC11e-101A0A0L9VAC1_PHAAN; Uncharacterized protein
STRINGevm.model.supercontig_65.1411e-134(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48902747
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.19e-70homeobox-leucine zipper protein 17