PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_625.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 281aa    MW: 30774.2 Da    PI: 7.3588
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_625.2genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.43.8e-231864349
                                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                                 i+  +n qvtf+kRr+gi+KKA+E+S+LC++evaviifs+t k++ +
  evm.model.supercontig_625.2 18 IKKATNLQVTFAKRRAGIFKKASEISTLCGTEVAVIIFSPTKKVFSF 64
                                 8999****************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.642868IPR002100Transcription factor, MADS-box
SMARTSM004324.8E-31867IPR002100Transcription factor, MADS-box
CDDcd002658.56E-35976No hitNo description
SuperFamilySSF554551.18E-26990IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-181030IPR002100Transcription factor, MADS-box
PfamPF003192.1E-221764IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-183045IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-184566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MEPPRKSKGR QKIEMVKIKK ATNLQVTFAK RRAGIFKKAS EISTLCGTEV AVIIFSPTKK  60
VFSFGSPSVE KLINRFNGLI EQPPSANRPA LEELQENVIK LANEKDAEED NINPNSDDQL  120
FLGSSSNGTR LLFESIPFNA AVGPRNVVNP NMVNPNVISP SMINPNMVNP AAYMKMLLNM  180
LNNNNPNMPV SNSMIPSNPN MVSNVMPTNS NPTNMMLSAA NLMIDNDQNT VPANHMMMNN  240
DLNDSNMMYT NGLNSVDMIP ATGYNMTQNN GGNGQEFFSI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A6e-15976269MEF2C
5f28_B6e-15976269MEF2C
5f28_C6e-15976269MEF2C
5f28_D6e-15976269MEF2C
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_625.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2386371e-128AC238637.1 Carica papaya BAC clone 99B01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021904035.10.0serum response factor homolog B-like
STRINGevm.model.supercontig_625.20.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-32AGAMOUS-like 62