PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_62.78
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family B3
Protein Properties Length: 391aa    MW: 44347.7 Da    PI: 7.8088
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_62.78genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.67e-1622108698
                                  ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                           B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                                  + ++ l+ + l++p kf++++g+  e s  +tl+ ++g +W v +  +k  +++++ +GW eFv+   +++g f+vF+++g+
  evm.model.supercontig_62.78  22 IVASILEDKKLRIPDKFVRRYGE--ELSSVVTLTVPNGGVWLVVF--EKVNQKFWFLNGWHEFVEYYSIQAGYFLVFRYEGK 99 
                                  5566677888***********94..58889***************..999999***************************99 PP

                                  SEE..EEEEE- CS
                           B3  88 sefelvvkvfr 98 
                                  s+f  +v++++
  evm.model.supercontig_62.78 100 SNF--NVHIYD 108
                                  999..777665 PP

2B359.65.5e-19288378498
                                  E-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                           B3   4 vltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                                  +l ps+v k  +l +p +fa+++ +g++     +tl+ ++g++W+v++     +g+  l+kGW eFv +n+L+egD++vF+l
  evm.model.supercontig_62.78 288 ILRPSYVYKGLLLHMPCRFARKYlSGVTGF---ITLQVPEGKEWTVRC--VTVDGAARLGKGWPEFVWQNDLNEGDVCVFEL 364
                                  6889*******************8777544...***************..88888899************************ PP

                                  -SSSEE..EEEEE- CS
                           B3  85 dgrsefelvvkvfr 98 
                                  +++++  l+v++fr
  evm.model.supercontig_62.78 365 ISTKSVVLKVTIFR 378
                                  **99999*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.35E-2215108IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.1E-2216108IPR015300DNA-binding pseudobarrel domain
CDDcd100173.59E-1917108No hitNo description
PROSITE profilePS5086313.59217110IPR003340B3 DNA binding domain
SMARTSM010192.0E-1618110IPR003340B3 DNA binding domain
PfamPF023627.8E-1324108IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.8E-24277378IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-24278378IPR015300DNA-binding pseudobarrel domain
CDDcd100171.84E-21283378No hitNo description
PROSITE profilePS5086313.676285380IPR003340B3 DNA binding domain
SMARTSM010196.7E-16285380IPR003340B3 DNA binding domain
PfamPF023622.5E-17287378IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MSLPVGPGLP EKDGSCIFYK LIVASILEDK KLRIPDKFVR RYGEELSSVV TLTVPNGGVW  60
LVVFEKVNQK FWFLNGWHEF VEYYSIQAGY FLVFRYEGKS NFNVHIYDLR TSEIKYPCAT  120
VCNSQEPHHH DKQPLPDSVN DGQNNAPGKI MDSKIKQALT TYGNMSMNNG TSEDYLPKTD  180
AKDGTETFRP TRDIGIQIDA NRLMTAADEV DLHLNIGAEP RTKKIKQETE SDEHESIGKV  240
QVKQELPGTE AFSRTYIRRE RIFTAEEKER AYNAALMFKP NNPSCTVILR PSYVYKGLLL  300
HMPCRFARKY LSGVTGFITL QVPEGKEWTV RCVTVDGAAR LGKGWPEFVW QNDLNEGDVC  360
VFELISTKSV VLKVTIFRVV EFARAPAMKH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-4225938223145B3 domain-containing transcription factor VRN1
4i1k_B2e-4225938223145B3 domain-containing transcription factor VRN1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_62.78
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021896597.10.0B3 domain-containing transcription factor VRN1-like
TrEMBLA0A1U8IF371e-123A0A1U8IF37_GOSHI; B3 domain-containing transcription factor VRN1-like isoform X2
STRINGevm.model.supercontig_62.780.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112428103
Representative plantOGRP20511436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-82B3 family protein