PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_61.32
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LBD
Protein Properties Length: 125aa    MW: 14708.6 Da    PI: 7.8458
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_61.32genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260107.41.1e-33201182100
                       DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilkl 83 
                                  Ca+Ck++rr+C + C +apyfp ++ ++f+n++klFG sn+++l+++ + ++r++a++sl++e+++r +dP++G++gv+ +l
  evm.model.supercontig_61.32  20 CASCKHQRRRCYERCEMAPYFPISRFSEFQNAQKLFGISNIHRLIHSFESSKRQEAADSLLMEGNMRYNDPMHGCLGVVCEL 101
                                  ********************************************************************************** PP

                       DUF260  84 qqqleqlkaelallkee 100
                                    ++e  ++elal++++
  evm.model.supercontig_61.32 102 IANIELFEKELALVNQQ 118
                                  *************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.60218119IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-3120116IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MNNRDENQQD RQKQQQQPTC ASCKHQRRRC YERCEMAPYF PISRFSEFQN AQKLFGISNI  60
HRLIHSFESS KRQEAADSLL MEGNMRYNDP MHGCLGVVCE LIANIELFEK ELALVNQQFH  120
HFRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-202011212104LOB family transfactor Ramosa2.1
5ly0_B3e-202011212104LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_61.32
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006475549.11e-44LOB domain-containing protein 22-like
TrEMBLA0A2H5PIN19e-44A0A2H5PIN1_CITUN; Uncharacterized protein
TrEMBLV4UQJ28e-44V4UQJ2_9ROSI; Uncharacterized protein (Fragment)
STRINGevm.model.supercontig_61.324e-88(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.19e-28LOB domain-containing protein 22