PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_61.31
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LBD
Protein Properties Length: 217aa    MW: 24316.6 Da    PI: 5.9838
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_61.31genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26077.42.5e-2418418101
                       DUF260  18 lapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                                  +apyfp ++ ++f+n++klFG sn+++l+++l+ ++r++a++sl++e+++r +dPv+G++gv+ +l+ ++e  ++elal+++
  evm.model.supercontig_61.31   1 MAPYFPISRFSEFQNAQKLFGISNIHRLIHSLESSKRQEAADSLLMEGNMRCNDPVHGCLGVVCELKAKIELFEKELALVNQ 82 
                                  59******************************************************************************99 PP

                       DUF260 100 el 101
                                  +l
  evm.model.supercontig_61.31  83 QL 84 
                                  86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089117.408184IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-21181IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MAPYFPISRF SEFQNAQKLF GISNIHRLIH SLESSKRQEA ADSLLMEGNM RCNDPVHGCL  60
GVVCELKAKI ELFEKELALV NQQLHHFRSQ RDDEQMQQVK GKLVDDELPP ILTLSSLTPQ  120
SDTLDMPPPF LVEHNSDDLE IFHNGYKDPL PTGKELGLEF QGVGNLHHNY PAKLLSYRTG  180
ESSSAAILYN EKLKQEVKDV VSAVPISKKG KEHIEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-1418728114LOB family transfactor Ramosa2.1
5ly0_B9e-1418728114LOB family transfactor Ramosa2.1
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_61.31
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006475549.13e-37LOB domain-containing protein 22-like
STRINGevm.model.supercontig_61.311e-159(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-20LOB domain-containing protein 22