PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_6.72
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 98aa    MW: 11080.8 Da    PI: 9.9642
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_6.72genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF61.69.2e-201255447
                                -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
                      SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                                +nk n+++tfs R+n + KKA+ELS+LC+++ a+i f +tgkl 
  evm.model.supercontig_6.72 12 KNKANKSITFSHRKNSLVKKAYELSTLCEIDLALIFFTPTGKLS 55
                                79****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.1E-17160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.82161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.37E-22284IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-14323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-171255IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-142338IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-143859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MGRPKTKLGE GKNKANKSIT FSHRKNSLVK KAYELSTLCE IDLALIFFTP TGKLSLFDGK  60
SSVEETLERY LNLPPPCRER YAVHFEGGEM RLNYIKQ*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_6.72
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021908260.14e-51serum factor response D-like
SwissprotQ9LM461e-22AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLA0A022QCZ82e-24A0A022QCZ8_ERYGU; Uncharacterized protein
STRINGevm.model.supercontig_6.726e-66(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77950.24e-26AGAMOUS-like 67
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]