PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_6.423
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LBD
Protein Properties Length: 255aa    MW: 27990.5 Da    PI: 7.9604
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_6.423genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.4e-429107199
                       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilk 82 
                                  +CaaCk+lrrkC+++Cv+apyfp +qp+kfa+vhk+FGasnv k+l++l++ +reda++sl+yeAear+rdPvyG+vg+i+ 
  evm.model.supercontig_6.423   9 PCAACKFLRRKCTQECVFAPYFPPDQPQKFAYVHKVFGASNVAKILNELNTAHREDAVNSLFYEAEARLRDPVYGCVGLISI 90 
                                  7********************************************************************************* PP

                       DUF260  83 lqqqleqlkaelallke 99 
                                  lq++l+q +++l  +k+
  evm.model.supercontig_6.423  91 LQHRLKQIQNNLLIAKK 107
                                  *********99988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.1058109IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-429105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSSSSSNSPC AACKFLRRKC TQECVFAPYF PPDQPQKFAY VHKVFGASNV AKILNELNTA  60
HREDAVNSLF YEAEARLRDP VYGCVGLISI LQHRLKQIQN NLLIAKKDLS NYIGLPAMLP  120
TIQAPPGAAF RPQSHLGVGS SPLMNHNMMM PMMDQTSHGG GQTQQQIFEL QGVNDQHHHQ  180
HQEMFRSYDQ QAELVSFSNS GFETSTGSVA TTGFGQKNNS SINNNSNINP LLGSLALGTS  240
GFETSYRIQT HRAD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4921244131LOB family transfactor Ramosa2.1
5ly0_B2e-4921244131LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_6.423
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021908106.10.0LOB domain-containing protein 36-like
SwissprotQ9FKZ38e-75LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A2C9URI92e-84A0A2C9URI9_MANES; Uncharacterized protein
STRINGevm.model.supercontig_6.4230.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-70ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]