PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_6.41
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GRAS
Protein Properties Length: 433aa    MW: 48234.2 Da    PI: 5.8701
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_6.41genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS301.52.1e-92314292373
                        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl. 83 
                                 ++lL++cA+a++s+d++laq++L+ l+++a pdgd++qRl+  f++AL ar a+++s ++ a ++ ++++ n ++ ++ +++ 
  evm.model.supercontig_6.41  31 EQLLVHCANAIDSNDATLAQQILWVLNNIAPPDGDSNQRLTCAFLRALIARAAKTGSCTMLAAAMANAHSCNLATDTHKFSVi 113
                                 79****************************************************76666666666666655644444444333 PP

                        GRAS  84 ....fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeel 158
                                     f++++P+++f++ +aN aIl+aveg  ++Hi+D+++++++Q p+Ll+a+a+R egpp +++T+ g  e +       ++
  evm.model.supercontig_6.41 114 elasFVDLTPWHRFGFTAANAAILDAVEGYAAIHIVDLSLTHCMQIPTLLDAIANRLEGPPLVKLTVAGGIEDVpppmLDLSY 196
                                 4488**************************************************************99998877887778899 PP

                        GRAS 159 eetgerLakfAeelgvpfefnvl.......vakrledleleeLrvkp......gEalaVnlvlqlhrll............de 216
                                 ee+g++L +fA++ ++ +ef+++       +    ++l +e+Lrv++      +Eal++n++++lh++              +
  evm.model.supercontig_6.41 197 EELGSKLVNFARSRNIMLEFRAIpssytdgY----SAL-IEQLRVQHllypesNEALVINCHMMLHYIAeetlsplispntTN 274
                                 **********************977633333....333.66666666666669****************9********99888 PP

                        GRAS 217 svsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvva 299
                                 +++ +s r+ +Lk +++l P+vvvvv+++ad +s++++ r+ +a++y++  +d++++ lpr s++r+++E+  + ++i+nv+a
  evm.model.supercontig_6.41 275 PTTATSLRTIFLKELRGLDPTVVVVVDEDADFTSNNLVCRLRSAFNYMWIPYDTIDTFLPRGSKHRQWYEAD-ICWKIENVIA 356
                                 88888899****************************************************************.********** PP

                        GRAS 300 cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                 +eg +r+er e +++W +r+++a F+ + ++e+a++++k++l +++  g+ ++ e++ lvl+Wk++++v++++W
  evm.model.supercontig_6.41 357 HEGLQRVERVEPKSRWVQRMRNASFRGLGFGEEAVSEVKTMLDEHA-AGWGLKREEDDLVLTWKGHNVVFATVW 429
                                 **********************************************.8999*********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.5684411IPR005202Transcription factor GRAS
PfamPF035147.3E-9031429IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MNKNQLHRTR PWPGFPTSKA FGNFGDANCM EQLLVHCANA IDSNDATLAQ QILWVLNNIA  60
PPDGDSNQRL TCAFLRALIA RAAKTGSCTM LAAAMANAHS CNLATDTHKF SVIELASFVD  120
LTPWHRFGFT AANAAILDAV EGYAAIHIVD LSLTHCMQIP TLLDAIANRL EGPPLVKLTV  180
AGGIEDVPPP MLDLSYEELG SKLVNFARSR NIMLEFRAIP SSYTDGYSAL IEQLRVQHLL  240
YPESNEALVI NCHMMLHYIA EETLSPLISP NTTNPTTATS LRTIFLKELR GLDPTVVVVV  300
DEDADFTSNN LVCRLRSAFN YMWIPYDTID TFLPRGSKHR QWYEADICWK IENVIAHEGL  360
QRVERVEPKS RWVQRMRNAS FRGLGFGEEA VSEVKTMLDE HAAGWGLKRE EDDLVLTWKG  420
HNVVFATVWV PT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B5e-481743274475Protein SHORT-ROOT
5b3h_B2e-481743220421Protein SHORT-ROOT
5b3h_E2e-481743220421Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_6.41
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021908184.10.0scarecrow-like protein 32
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A2P5XRM20.0A0A2P5XRM2_GOSBA; Uncharacterized protein
STRINGevm.model.supercontig_6.410.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54452750
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.10.0GRAS family protein