PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_6.406
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 344aa    MW: 36562.1 Da    PI: 8.5554
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_6.406genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.2e-3985144261
                       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                  ++++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk++
  evm.model.supercontig_6.406  85 ENQNLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKNT 144
                                  57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2585142IPR003851Zinc finger, Dof-type
PfamPF027012.0E-3287143IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.54489143IPR003851Zinc finger, Dof-type
PROSITE patternPS01361091127IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MIQELLGATG LINGGLDHHR HKISFNPTIL EAALSPSSSP SPSSSSSSSS SSSSSGATTT  60
VTTVNNSCST TTTSVTTNSN STTSENQNLR CPRCDSSNTK FCYYNNYNLT QPRHFCKTCR  120
RYWTKGGALR NVPIGGGCRK NKNTTLSTSI TKSNAAAKLK SVVSEIGRSG GLANGFDHDQ  180
LPSTPFLWTA SPHNSHLLAL LRQPQNPNTT TLLSNQVSSV KEEPLGVDPL SQVPSLGLSS  240
SLWKNPSQNQ TQQNGFLSGE EQTSSGIQEL YQRLRSSAST YYNDNSAAVH LSNMACSSSS  300
TSSSSSSYTL ESAPMAPTEL GYTWNNPAFS WADLSTTNGA YPL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_6.406
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021908042.10.0LOW QUALITY PROTEIN: dof zinc finger protein DOF5.7-like
TrEMBLA0A1R3GFA11e-102A0A1R3GFA1_COCAP; Zinc finger, Dof-type
STRINGevm.model.supercontig_6.4060.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16000915
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.17e-34TARGET OF MONOPTEROS 6