PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_6.395
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LBD
Protein Properties Length: 204aa    MW: 22759.6 Da    PI: 10.0923
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_6.395genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.41.2e-383100198
                       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilk 82 
                                  aCaaC++++rkC+++Cvlapyfpa++++kf +++k+FG+s+v+k+l++l+ ++re+a++s+vyeAear+rdPv+G++g+++k
  evm.model.supercontig_6.395   3 ACAACRFHKRKCEEECVLAPYFPADERQKFDCINKVFGTSRVTKILNRLDASQREAAVKSIVYEAEARLRDPVRGCAGLVSK 84 
                                  7********************************************************************************* PP

                       DUF260  83 lqqqleqlkaelallk 98 
                                  l ++l+ ++ael  ++
  evm.model.supercontig_6.395  85 LLNRLQLVEAELLNAR 100
                                  **********997665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.3782103IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-36399IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MSACAACRFH KRKCEEECVL APYFPADERQ KFDCINKVFG TSRVTKILNR LDASQREAAV  60
KSIVYEAEAR LRDPVRGCAG LVSKLLNRLQ LVEAELLNAR RLLDTVIAPQ AILPMQQPLG  120
MGSSIHYNIV PIMGNPPVHS HTGGQLLVFG AYIERLRVVN VAVHHHEKAP QGYPSRPSYY  180
RGALKRKTFA LIVDNRGRIF VIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-3029610104LOB family transfactor Ramosa2.1
5ly0_B7e-3029610104LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_6.395
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021908382.11e-104LOB domain-containing protein 36-like
SwissprotQ9FKZ31e-43LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A2P6RN882e-45A0A2P6RN88_ROSCH; Putative transcription factor AS2-LOB family
TrEMBLA0A2R6R6B42e-45A0A2R6R6B4_ACTCH; LOB domain-containing protein
STRINGevm.model.supercontig_6.3951e-149(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-46ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]