PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_6.327
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family SBP
Protein Properties Length: 193aa    MW: 22507.2 Da    PI: 8.4889
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_6.327genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP123.68.7e-3972147176
                                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                                  +Cq+++C ++l +ak yhrrhkvCe h+kapvvlv+g++qrfCqqCsrfh +sefD+ krsCr+rLa+hnerrrk 
  evm.model.supercontig_6.327  72 CCQADECGKELVDAKAYHRRHKVCERHAKAPVVLVKGVRQRFCQQCSRFHGISEFDNFKRSCRSRLAGHNERRRKL 147
                                  6*************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.7E-3170134IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.03470147IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-3571150IPR004333Transcription factor, SBP-box
PfamPF031109.0E-3173146IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MAKRSFVSEG EEQYNDLETE QESEIEEDEG EEEEEKHQRE KMIIIRVVSG GERRGFQLES  60
NSDNGSGGIY LCCQADECGK ELVDAKAYHR RHKVCERHAK APVVLVKGVR QRFCQQCSRF  120
HGISEFDNFK RSCRSRLAGH NERRRKLLSD QKMQKYVEKS KTSNNTVEHT RFQKSDQVVL  180
QNNRKIKRVR IE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-3264146384squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007046540.18e-46Squamosa promoter-binding protein-like 12
TrEMBLA0A061DFJ29e-46A0A061DFJ2_THECC; Squamosa promoter-binding protein-like 12
STRINGVIT_04s0210g00170.t016e-38(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.16e-34squamosa promoter binding protein-like 3