PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_6.206
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 340aa    MW: 36802 Da    PI: 5.7334
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_6.206genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.81.5e-18257291135
                         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                  Cs+Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  evm.model.supercontig_6.206 257 CSHCGVQKTPQWRTGPLGAKTLCNACGVRYKSGRL 291
                                  *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.3E-891333IPR016679Transcription factor, GATA, plant
SMARTSM004013.4E-16251305IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.057251287IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.04E-14252313No hitNo description
Gene3DG3DSA:3.30.50.101.1E-14255289IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.43E-14256304No hitNo description
PfamPF003201.9E-16257291IPR000679Zinc finger, GATA-type
PROSITE patternPS003440257282IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MECIEAALKS SFRREMAMKT SPQAFFDDDT PNGLSCEDFF VDDLLDLSNG DGFVEKEAGK  60
EEEEDDEGKV SAGCVEGQEG LKQSLGFSSG DDFGFVDATE LAVPSDDLAD LEWLSHFVED  120
SFSEYSVAYP TGALPEKPKW QTPSCHAQLA PSFAEKPCFK TPIPAKARSK RTRTGGRVWS  180
LGSLSLTESS SSSTSSTSSS PSNSSPWLIG INPVWRPSLD QPAEPVSWEK PPAKKAKKKS  240
GTDSAAPNGG SQPPRRCSHC GVQKTPQWRT GPLGAKTLCN ACGVRYKSGR LLPEYRPACS  300
PTFSSELHSN HHRKVLEMRR KKESSQPEPG LVSSPLTSF*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_6.206
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021907860.10.0GATA transcription factor 5
SwissprotQ9FH574e-87GATA5_ARATH; GATA transcription factor 5
TrEMBLM5WGI31e-118M5WGI3_PRUPE; GATA transcription factor
STRINGevm.model.supercontig_6.2060.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36982561
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.26e-83GATA transcription factor 5