PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_55.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 316aa    MW: 34348.6 Da    PI: 8.4807
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_55.3genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.5e-393393262
                      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                +e++l+cprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk +
  evm.model.supercontig_55.3 33 QEQTLRCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKIK 93
                                57899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.2E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3663791IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-263791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MSSDHLGAKP VTKDHDSQSS GNRKSTAASG RPQEQTLRCP RCDSPNTKFC YYNNYSLTQP  60
RHFCKTCRRY WTKGGALRNV PIGGGCRKNK KIKSSSSSSS RLSGDSGGSS LEIGGFKFFH  120
GLAPAMDFQL PRLNPSPTGF YNQFSSFGLD STCTSSFSLD HHHQAGSSGN NNSSLLGFNY  180
PLSSVATTSG AIHDLGSGGS VNVSSNLASS IESLSSLNQD LHWKLQQQRL AMLFGEENQK  240
ENDNVSSVPL EKPQPILFHN LENSRKESVN SETATEWFFG NSYAPTPTNS TANDTTNNWN  300
GVQAWNDLHQ YSSLP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_55.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021897555.10.0dof zinc finger protein DOF5.7-like
TrEMBLA0A061DI281e-142A0A061DI28_THECC; Dof-type zinc finger DNA-binding family protein
STRINGevm.model.supercontig_55.30.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49502850
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.14e-36Dof family protein