PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_546.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 305aa    MW: 32951.7 Da    PI: 5.4501
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_546.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                                  C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  evm.model.supercontig_546.1 248 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 281
                                  99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.6E-684299IPR016679Transcription factor, GATA, plant
SMARTSM004011.7E-16242292IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.583242278IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.57E-13243292No hitNo description
Gene3DG3DSA: finger, NHR/GATA-type
CDDcd002028.64E-15247297No hitNo description
PROSITE patternPS003440248273IPR000679Zinc finger, GATA-type
PfamPF003202.0E-15248281IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021905603.10.0LOW QUALITY PROTEIN: GATA transcription factor 8-like
TrEMBLA0A061FV651e-137A0A061FV65_THECC; GATA transcription factor
STRINGevm.model.supercontig_546.10.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.22e-34GATA family protein