PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_546.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 305aa    MW: 32951.7 Da    PI: 5.4501
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_546.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.38.8e-18248281134
                         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                                  C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  evm.model.supercontig_546.1 248 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 281
                                  99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.6E-684299IPR016679Transcription factor, GATA, plant
SMARTSM004011.7E-16242292IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.583242278IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.57E-13243292No hitNo description
Gene3DG3DSA:3.30.50.108.3E-15246279IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.64E-15247297No hitNo description
PROSITE patternPS003440248273IPR000679Zinc finger, GATA-type
PfamPF003202.0E-15248281IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGPNFIDEID CGSFFDHIDD LLDFPGEDIE AGLGSAADSN SLPTIWPTQS ESLPGSESVF  60
SGNSSSDLSA ELSVPYEDIL QLEWLSNFVE DSFSGGSLAM NKEESSCVTK DSSHNQFQTS  120
SPVSVLESSS SYSGDKTAPR SPDTVAVGRC GRPRSKRPRP ATFNPRPSQL ISPLSSVNEN  180
WTMQPLVADP SPKGSSDSEN VVQSRLVIKI PKQVATEHKK KKKKIKLSAP EGNSDTNQNQ  240
PSQPVRKCMH CEITKTPQWR AGPMGPKTLC NACGVRYKSG RLFPEYRPAA SPTFGQVREG  300
IGEP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155159KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015877215.11e-140PREDICTED: GATA transcription factor 8-like isoform X1
RefseqXP_015877217.11e-140PREDICTED: GATA transcription factor 8-like isoform X2
TrEMBLA0A061FV651e-139A0A061FV65_THECC; Plant-specific GATA-type zinc finger transcription factor family protein isoform 2
STRINGPOPTR_0010s23010.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49752751
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.22e-34GATA family protein