PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_51.124
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 223aa    MW: 25425 Da    PI: 9.8263
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_51.124genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.86.7e-191152344
                                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                                  i+++s r++tf kR++g++KKA+EL +LC+++ +v+i+s+ +
  evm.model.supercontig_51.124 11 ISDESSRKITFQKRKKGLMKKASELATLCGINLCVMIYSPYN 52
                                  99*************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-22160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.904149IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-9323IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-22495IPR002100Transcription factor, MADS-box
CDDcd002665.67E-28485No hitNo description
PfamPF003193.5E-191152IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MKGRKVKLDL ISDESSRKIT FQKRKKGLMK KASELATLCG INLCVMIYSP YNTQPEIWPS  60
PLGVQSVIND FSAMSKRDQN KKMLNQGTYL RQSIKKANDQ LNKLRKDNRD KEITQFMSES  120
LNGKPLTNLT AKDLKDLDCK IKYFSNDIDK MIDKHITTDQ KFENGQTKTS GIDLNDGDNL  180
QNSLKNHSWL MELGFERMIM PMGDKHNKDI DNNNNNNDNG AT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_51.124
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021898171.11e-162agamous-like MADS-box protein AGL80
STRINGevm.model.supercontig_51.1241e-162(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.19e-41AGAMOUS-like 38