PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_505.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 380aa    MW: 41684.8 Da    PI: 4.3207
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_505.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.45.2e-15241443
                                 -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                       SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                                 en+   qvtfsk r  ++KKA+EL++LC  +v +i+fs+ 
  evm.model.supercontig_505.1  2 ENEASLQVTFSKHRSSLFKKASELCTLCRPDVGLIVFSPG 41
                                 788899********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.792151IPR002100Transcription factor, MADS-box
SMARTSM004323.2E-10150IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-16264IPR002100Transcription factor, MADS-box
PfamPF003192.4E-17244IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-51328IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-52849IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MENEASLQVT FSKHRSSLFK KASELCTLCR PDVGLIVFSP GKRAIGYGNP NIDIVIDRFL  60
SIDVRPARDP DNDNDTQETI SNITKAQDKE AARKRGKELK QRRKGLMKEL WHTRSMDKFN  120
LEELEVLDAG MKALWNDVAE LAKKLKKEQG NSSSAEGSLR DDRMFYSDPA MKALNTLPMP  180
SMPSNPTHEY TPSSTNSTPP LSSFCNLDSG NPKIMMMDNP LNDSSMALDP VDDLKAMPRD  240
LFNNLVMIES DDPIAALNAG DNPDIMSDAF GNQIATMDIN LSNDPNIGPN EIFNPSTMPH  300
APNDPISTTS NALNMIRIVP DDSNLDSIFD GFTLEMLFAD PLDDENFIVD NPNEVANGDN  360
SKTMPPPLAG NVLGSGQGF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_505.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ4103950.0KJ410395.1 Carica papaya sex-specific marker RX15_10 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021911410.10.0agamous-like MADS-box protein AGL62
STRINGevm.model.supercontig_505.10.0(Carica papaya)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-24AGAMOUS-like 62