PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_50.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family VOZ
Protein Properties Length: 455aa    MW: 51153.6 Da    PI: 6.2961
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_50.3genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ432.65.3e-1332074231217
                         VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecega 83 
                                 pppsafl+pkc+lwdctrpa gs+w+qdycs fhatlalne++pgttp++rp+gi+lkd+ll++al++k++gk+vgip+cega
  evm.model.supercontig_50.3 207 PPPSAFLRPKCSLWDCTRPALGSDWYQDYCSIFHATLALNEDPPGTTPTVRPGGIGLKDNLLLDALRSKTEGKNVGIPTCEGA 289
                                 89********************************************************************************* PP

                         VOZ  84 atakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfe 166
                                 a++k+pwna+elfdl lleget+rewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgg+krsyymdpqp+++fe
  evm.model.supercontig_50.3 290 ASRKCPWNATELFDLGLLEGETVREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMKEFGGQKRSYYMDPQPPGCFE 372
                                 *********************************************************************************** PP

                         VOZ 167 whlyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                                 w+lyeyei+++da+alyrlelklv+e+ks+kgkv+kd+++dlqkk+grlta
  evm.model.supercontig_50.3 373 WRLYEYEIYSFDACALYRLELKLVKERKSPKGKVNKDPVVDLQKKMGRLTA 423
                                 *************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MKNHPRSKCT SISHQTLIDN AKNRVSDLQE RFTNLQAART EGRIGDVAVL EEQVYQSLRE  60
WKAELNAPSP ASSSFGCSLG SFSDDIARML QLCEEEDDAS SAFAEPACLK PESAVQSLCP  120
GNILGVQENC FHNNEAQEQK FQVFDQCKSP KSTMHSTMVN NAELTHQLDY DLLNSHNELN  180
HELFIGASDI EECAKDSGPN ILPSIHPPPS AFLRPKCSLW DCTRPALGSD WYQDYCSIFH  240
ATLALNEDPP GTTPTVRPGG IGLKDNLLLD ALRSKTEGKN VGIPTCEGAA SRKCPWNATE  300
LFDLGLLEGE TVREWLFFDK PRRAFESGNR KQRSLPDYSG RGWHESRKQV MKEFGGQKRS  360
YYMDPQPPGC FEWRLYEYEI YSFDACALYR LELKLVKERK SPKGKVNKDP VVDLQKKMGR  420
LTAEVPSDNN NRYVVRGMPT EHRVINQLTI KALN*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_50.3
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-49AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021898421.10.0transcription factor VOZ2-like
RefseqXP_021898422.10.0transcription factor VOZ2-like
SwissprotQ9SGQ01e-167VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A061E3L60.0A0A061E3L6_THECC; Vascular plant one zinc finger protein isoform 1
STRINGevm.model.supercontig_50.30.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Representative plantOGRP23271335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42400.11e-139vascular plant one zinc finger protein 2
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]