PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_50.154
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LBD
Protein Properties Length: 87aa    MW: 9772.22 Da    PI: 5.7154
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_50.154genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260415.4e-1314358100
                        DUF260  58 msslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                   m+sl +eA++r++dPvyG+vg+i+ lq+q+++++++la++++e
  evm.model.supercontig_50.154   1 MDSLNFEAQCRIEDPVYGCVGIISLLQKQIQKAETQLAKMQAE 43 
                                   79************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.485144IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-11141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MDSLNFEAQC RIEDPVYGCV GIISLLQKQI QKAETQLAKM QAEIAVYSSY FAHFDNFSPI  60
PFSIINTSKL TYWLTQAGFR SCLNNI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_50.154
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021910100.16e-21LOB domain-containing protein 24-like
SwissprotP594685e-17LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A1R3K6298e-17A0A1R3K629_9ROSI; Uncharacterized protein
STRINGevm.model.supercontig_50.1541e-58(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-19LOB domain-containing protein 24