PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_5.51
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 506aa    MW: 55265.1 Da    PI: 8.8185
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_5.51genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.37.8e-09158220163
                                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                      bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                 eke +r rr   NRe+Ar   +R++a +eeL++k++ L  eN +Lk e +   ke+++l++ +
  evm.model.supercontig_5.51 158 EKEERRIRRVLANRESARQTIRRRQALCEELTQKAADLARENVQLKMEKDLALKEYQSLETIN 220
                                 78999*****************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.9E-6155223No hitNo description
PfamPF001701.4E-7158220IPR004827Basic-leucine zipper domain
SMARTSM003384.0E-10158222IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.864160223IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-5162217No hitNo description
CDDcd147027.19E-14163214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MHCERGLVLS TSSSSSPFNP PSSAGTSAED AADMVADRTE MEAAEALADM AQLAMREKPA  60
ESPAKWGSKG KRVRKRVKSE SSPSDSRLSL VDSAPPCPDL AEDQAGQSEQ KVQASRRNKS  120
TKLGKSEQDT ELGKQTPVVP RCTSTGSGRS RQNLTEAEKE ERRIRRVLAN RESARQTIRR  180
RQALCEELTQ KAADLARENV QLKMEKDLAL KEYQSLETIN KQLKAQISKA TKPEAGQAVE  240
QPPHLNISAS PSTTYPVMLF NQNPLQPLCW PSVVQASHPI QSQHGPPTAL VVPSGIPAQA  300
PGNLLLSQEQ ENPVKSNGPR TPIYIVPCPW FFPLPDHGNG LHLQSSSGMK NMHDENSVNN  360
SYSSVPSLKT ITGIENHISH SPTEKVKEET SSSTESKHAN DLNEVPAGFP HDGGSHYIGL  420
HPKEMMLAPL PQSSMGPPFT FKQENVFPSD YVGHVLTVFP EKNQGTVDYS SKKMVDTVAA  480
AEARKRRKEL TKIKNLNSRQ CRTPA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1483488RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_5.51
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021908715.10.0light-inducible protein CPRF2 isoform X1
TrEMBLA0A2H5MZ111e-152A0A2H5MZ11_CITUN; Uncharacterized protein
STRINGevm.model.supercontig_5.510.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Representative plantOGRP45691318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.18e-62bZIP family protein