PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_49.48
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 242aa    MW: 27271.9 Da    PI: 4.9802
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_49.48genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.84.3e-372580661
                       zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                                  +cprC s+ntkfCyynnyslsqPry+CkaCrryWtkGG+lrnvPvGgg+rkn+++
  evm.model.supercontig_49.48 25 PNCPRCSSSNTKFCYYNNYSLSQPRYLCKACRRYWTKGGSLRNVPVGGGCRKNRTR 80
                                 68***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-252078IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.1832579IPR003851Zinc finger, Dof-type
PfamPF027014.5E-322579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MLRDSYNDQM FELYCSNGRA MEVAPNCPRC SSSNTKFCYY NNYSLSQPRY LCKACRRYWT  60
KGGSLRNVPV GGGCRKNRTR TKSRLPPNYG KPNEPFGTRK SSPSQHTGSE SNIDLAVVFA  120
RFLNDQNEAD RFVGQEANAG TYRSGCYPPE RLGPEETSLS DQIVGDGGDG KQGEEEERSL  180
FGLVNDELVI QSRSISDYNI WPEDDDAAIN MPSFSWQLQD FSLLHDHFNN DNWNSFDLSG  240
F*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_49.48
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021898538.10.0dof zinc finger protein DOF1.2
RefseqXP_021898539.10.0dof zinc finger protein DOF1.2
STRINGevm.model.supercontig_49.480.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64622643
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.14e-38Dof family protein