PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_46.151
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family WRKY
Protein Properties Length: 330aa    MW: 36060.8 Da    PI: 5.0061
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_46.151genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY79.73.2e-25183239259
                                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                   +DgynWrKYGqK+vk+ + +rsYY+Ct+++C++kk +e+s++ ++v+e++++g H h+
  evm.model.supercontig_46.151 183 SDGYNWRKYGQKQVKSPKGSRSYYKCTYSNCSAKK-IECSDHSGHVIEVVNKGMHSHD 239
                                   7********************************98.*********************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.1E-20179241IPR003657WRKY domain
SuperFamilySSF1182904.05E-20180241IPR003657WRKY domain
SMARTSM007741.1E-23182240IPR003657WRKY domain
PROSITE profilePS5081117.362183241IPR003657WRKY domain
PfamPF031062.4E-17184239IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MAEAETCKAV QVERRERHEQ EPNDEFEELG NEASQLGQIS RRGEFPTSVP HNEAEVGDAS  60
LETLEKDQPG GLQKNSDAES NGEAELKERA REIHQEDLAG ATPQGGEAQP ENQLQSSICT  120
TSLSELSPTS VTQSISSAPS PTVQEQRLAP QKANSVCMPE DDQLNSSKVK TLTVVPIIKT  180
PSSDGYNWRK YGQKQVKSPK GSRSYYKCTY SNCSAKKIEC SDHSGHVIEV VNKGMHSHDP  240
PRKNNCMKEN RLLSSAAPAL GDTATEQPIR LLSDSDPSTS TKVPMHEIPI IPERKRQNSS  300
GSDGSGEIEV KEEQINELEA KKRQVGPLF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015384576.11e-100PREDICTED: probable WRKY transcription factor 32 isoform X1
TrEMBLA0A067EZZ31e-101A0A067EZZ3_CITSI; Uncharacterized protein (Fragment)
TrEMBLK4M4741e-101K4M474_PONTR; WRKY2
STRINGVIT_11s0037g00150.t015e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Representative plantOGRP10318610
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.13e-47WRKY DNA-binding protein 32