PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_439.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 245aa    MW: 27500 Da    PI: 10.1443
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_439.3genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF596.1e-191864349
                                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                                 i+  +n qvtf+kR + i+KKA+E+S+LC+ae aviifs+  k++ +
  evm.model.supercontig_439.3 18 IKKATNLQVTFAKRPASIFKKASEISTLCGAEFAVIIFSPAKKVFFF 64
                                 8999*************************************999866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.759868IPR002100Transcription factor, MADS-box
SMARTSM004327.3E-21867IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-22982IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-141030IPR002100Transcription factor, MADS-box
PfamPF003195.6E-181763IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-143045IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-144566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MEPPWKLKGR QMIEMVKIKK ATNLQVTFAK RPASIFKKAS EISTLCGAEF AVIIFSPAKK  60
VFFFVNPSME KLINRFSGLI EQPPSANRCM MDAHRNAYLQ GLNSQLNKLN AQLDAKKKRS  120
VELKKVMKEN ASKAWWMGSI DDMNLSQLQQ FQAALEELYE NVIKVAKEKD AEEDNINPNS  180
DDQLFLGSSS NRTGLPFESI PLNAIVGPRN MVNPNMNRVN SNMVNPNVIS PSMINPNMLI  240
LQLI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_439.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2386371e-159AC238637.1 Carica papaya BAC clone 99B01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021909162.11e-178agamous-like MADS-box protein AGL62
STRINGevm.model.supercontig_439.31e-177(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-36AGAMOUS-like 62