PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_438.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 323aa    MW: 36203.9 Da    PI: 4.5913
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_438.4genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.96.8e-11146198456
                                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                       bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                                   k+ rr  +NR AA rsR+RKk+++  Le k+k Le+e ++L   l+    e 
  evm.model.supercontig_438.4 146 AKKRRRQLRNRDAALRSRERKKMYVRDLEMKSKYLEGECRRLGRLLQCFAAEN 198
                                  6999**********************************998876666555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.9E-5143207IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.737145201IPR004827Basic-leucine zipper domain
PfamPF077163.7E-8146187IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.4E-11146202No hitNo description
SuperFamilySSF579592.63E-10147202No hitNo description
CDDcd147041.09E-16148199No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MDDQGFLGDD VVEKIELDPL FFDCSDWFNY EPPVLSDSSP VEAFSNPSPD SVPSKICEIE  60
SLLMNEDCSN DELPQEENQQ FYCDFLADIL VKSPVHGSAC SEDFVDAPID KETNIYDESG  120
NSGLEKEKTD GADINEDGYD PNDPIAKKRR RQLRNRDAAL RSRERKKMYV RDLEMKSKYL  180
EGECRRLGRL LQCFAAENQA LHLSLHNGGS AFGASRAKQE SAVLLLESLL LGSLLWFLGI  240
MCLFSLPNLP QSALEAIQRE IMEKKDPESE APRGRGGEIY ISSVEESFAK SRRCKASRTR  300
MKLDLHVLKS FGIKAVLQVK SC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147166KRRRQLRNRDAALRSRERKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_438.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021909218.10.0bZIP transcription factor 60-like
TrEMBLA0A2I4FMW64e-79A0A2I4FMW6_JUGRE; bZIP transcription factor 60-like
STRINGevm.model.supercontig_438.40.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Representative plantOGRP54681518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.12e-23basic region/leucine zipper motif 60