PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_42.184
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 299aa    MW: 33449.3 Da    PI: 6.07
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_42.184genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.14.4e-17231264134
                          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                                   Cs+C + kTp+WR gp g+ktLCnaCG++y++ +
  evm.model.supercontig_42.184 231 CSHCLSDKTPQWRIGPMGPKTLCNACGVRYKSGR 264
                                   *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011410.857225261IPR000679Zinc finger, GATA-type
SMARTSM004012.1E-15225275IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.71E-13228287No hitNo description
Gene3DG3DSA:3.30.50.102.7E-13229262IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.63E-14230281No hitNo description
PfamPF003205.3E-15231264IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MAIDDINYDT TDLSDLFPDH LYSNLDYIDP KPDPLPAGFT YSAESQLCVP QDTLEDLEWF  60
PSFTDDFINL SGISLENETL SIKGSSYQND VVQEPLKLEN SKVSGDQNEA SRGPGNFEYS  120
KSFSDQNDAS QEPAKLENSI DRPVTPELKT EDTFGRANKR RREAEIEESE KLAFGFCSSG  180
QKKQRSKRDS CGKHERLLGW AVEKAMTSGT MSFGVTSGAT SFGVTERRKR CSHCLSDKTP  240
QWRIGPMGPK TLCNACGVRY KSGRLIPEYR PAASPTFNIL KHSNFHKKIL KRREFNGC*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_42.184
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021899856.10.0GATA transcription factor 7-like
STRINGevm.model.supercontig_42.1840.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17095911
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.13e-34GATA transcription factor 12