PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_365.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 279aa    MW: 31319.7 Da    PI: 6.9495
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_365.3genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.87.7e-152270250
                                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                 +i+nk  r+ ++ kR+ ++  KA+ LS+LCd+ v+++ f ++gkl +++
  evm.model.supercontig_365.3 22 FISNKDARKASLKKRQPTLKLKAQQLSTLCDVPVCLLCFDPDGKLDTWP 70
                                 8***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-51372IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.2781373IPR002100Transcription factor, MADS-box
CDDcd002661.54E-171493No hitNo description
PRINTSPR004045.9E-51535IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-151689IPR002100Transcription factor, MADS-box
PfamPF003194.2E-142269IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-53550IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-55071IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MEPSTPNLSA KPIKKRNRSL HFISNKDARK ASLKKRQPTL KLKAQQLSTL CDVPVCLLCF  60
DPDGKLDTWP ENQAQVREII MNYKNSIDPD DRAGKGSEHM DLLSFLEAKK KRLEEEKNEI  120
NRLKETDSSW DHRLDELPEA ELINLVGRLD STLQRLRERR DHLLHNNNHP SDNFTVTGCN  180
ENLGSLQSFG SAYENINNGG SGYNFVPSGD MQVMLEYQSM VTPLHEALLP LFPNNPAMLM  240
MPPRAALPPL FPNNPATLMA PPQAALPLSW WPPHAAGN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_365.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021911453.10.0agamous-like MADS-box protein AGL75
TrEMBLA0A4D6D2574e-80A0A4D6D257_CARPA; Floral homeotic protein
STRINGevm.model.supercontig_365.30.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1213926
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.12e-16AGAMOUS-like 103