PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_361.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 371aa    MW: 39614.8 Da    PI: 8.6739
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_361.3genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.6e-3977137262
                       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                  +e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  evm.model.supercontig_361.3  77 PEAALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 137
                                  67899*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3361126IPR003851Zinc finger, Dof-type
PfamPF027011.4E-3280135IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.54481135IPR003851Zinc finger, Dof-type
PROSITE patternPS01361083119IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MVFSSVPVYL DPPNWPLQQQ ANQHQEGGGV NSNDQHHYPH QNPHLPPPPP PPPPQAGVGI  60
RPGSMAERAR LAKIPQPEAA LKCPRCESTN TKFCYFNNYS LTQPRHFCKT CRRYWTRGGA  120
LRNVPVGGGC RRNKRSKGSS GNSSNSNCNS SSRSKSPAAI ADLAGAGQVH AGPSTSSSGA  180
AMASNSDIIS RMTSQLPILP PLHHLGSYNS TDIGLNFGGI QASMAAGGGD MEFHGGSNGL  240
VEQWRLNQVQ QFPFLTGLEP SPTTGLYSFD HGDHNQQAGV EQSSFVAQLR SSSKPVLEMI  300
SSGVTTTHLA AVKMEENDRE KGLNLSRNFL GNISGNNNND HNQYWAGGSS TTAWTDLTGF  360
ASSNSTTHLL *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_361.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021911589.10.0dof zinc finger protein DOF3.6-like isoform X1
TrEMBLA5BZE71e-102A5BZE7_VITVI; Uncharacterized protein
STRINGevm.model.supercontig_361.30.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.24e-67OBF-binding protein 3