PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_3486.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 61aa    MW: 6972.94 Da    PI: 10.8148
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_3486.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.21.4e-30958150
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                  +rienk+nrqvtfskRrng+lKK +ELSvLCdae+a+iifss+gkl+e+ 
  evm.model.supercontig_3486.1  9 ERIENKINRQVTFSKRRNGLLKKGYELSVLCDAEIALIIFSSRGKLFEFG 58
                                  69**********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.8E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.23161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-28260IPR002100Transcription factor, MADS-box
CDDcd002651.81E-35259No hitNo description
PRINTSPR004041.3E-31323IPR002100Transcription factor, MADS-box
PfamPF003192.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
MGRGKVVLER IENKINRQVT FSKRRNGLLK KGYELSVLCD AEIALIIFSS RGKLFEFGSH  60
X
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-21159159MEF2C
5f28_B2e-21159159MEF2C
5f28_C2e-21159159MEF2C
5f28_D2e-21159159MEF2C
6byy_A2e-21159159MEF2 CHIMERA
6byy_B2e-21159159MEF2 CHIMERA
6byy_C2e-21159159MEF2 CHIMERA
6byy_D2e-21159159MEF2 CHIMERA
6bz1_A2e-21159159MEF2 CHIMERA
6bz1_B2e-21159159MEF2 CHIMERA
6bz1_C2e-21159159MEF2 CHIMERA
6bz1_D2e-21159159MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Forms a heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_3486.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007038532.26e-32PREDICTED: MADS-box transcription factor 6 isoform X2
RefseqXP_017973049.15e-32PREDICTED: MADS-box transcription factor 6 isoform X1
RefseqXP_017973050.14e-32PREDICTED: MADS-box transcription factor 6 isoform X3
RefseqXP_022737294.19e-33MADS-box transcription factor 6-like
SwissprotP293868e-31AGL6_ARATH; Agamous-like MADS-box protein AGL6
TrEMBLA0A0D2SS445e-31A0A0D2SS44_GOSRA; Uncharacterized protein
TrEMBLA0A2N9FVP92e-31A0A2N9FVP9_FAGSY; Uncharacterized protein
STRINGevm.model.supercontig_3486.12e-35(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.13e-33AGAMOUS-like 6
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Dreni L,Zhang D
    Flower development: the evolutionary history and functions of the AGL6 subfamily MADS-box genes.
    J. Exp. Bot., 2016. 67(6): p. 1625-38
    [PMID:26956504]