PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_348.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 381aa    MW: 42016.2 Da    PI: 4.2795
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_348.7genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.86.9e-14242444
                                 -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                       SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                                 en+   qvtfsk r  ++KKA+EL++LC  +v  iifs+ +
  evm.model.supercontig_348.7  2 ENEASLQVTFSKHRSSLFKKASELCTLCRPDVGHIIFSPGD 42
                                 788899********************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.47151IPR002100Transcription factor, MADS-box
SMARTSM004327.6E-10150IPR002100Transcription factor, MADS-box
PfamPF003191.0E-16247IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.15E-16273IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MENEASLQVT FSKHRSSLFK KASELCTLCR PDVGHIIFSP GDRAFCYGNP NIDIVIDRFL  60
SIDVRPARDP HNDNDTQQTI SRITEALDKE EAVRKRGKEL KQRRKGLMKE LWYTRSMDKF  120
NLEELEVLDA GMKALWNDVA ELAKKLKKEQ GNSSSAEGSP RDDGMFYSDP AIMGLTTLPM  180
PSMPSNPTHE YAPSSINSTP PLSSFCNLDS GNPNIMMMDN PLNDSSMALD PVDDLKAMPR  240
DLFNNLVMIE SDDPIASLNA GDNPYIIFYA FGNQIATMDI NLSNDPNIGP NEFFNPSTMP  300
HAPNDPISTT SDALNMIRIV PNDSNLDSVF DGFTLEMLFA DPLDDENFIV DNPNEAANGD  360
NPKKMPPPLA GNVLGSGQGF *
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_348.7
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ4103950.0KJ410395.1 Carica papaya sex-specific marker RX15_10 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021887443.10.0agamous-like MADS-box protein AGL62
RefseqXP_021911410.10.0agamous-like MADS-box protein AGL62
STRINGevm.model.supercontig_348.70.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-27AGAMOUS-like 62