PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_347.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 109aa    MW: 12207.3 Da    PI: 10.0785
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_347.10genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF711.1e-221660347
                                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
                        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                                   +n++n qvtfskRr+g++KKA+ELS+LCd+++++i+fs+  k +
  evm.model.supercontig_347.10 16 MSNETNLQVTFSKRRAGLFKKASELSTLCDVDISMIVFSPGKKAF 60
                                  68*************************************987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-31665IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.352666IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.46E-26776IPR002100Transcription factor, MADS-box
CDDcd002651.84E-33774No hitNo description
PRINTSPR004041.0E-19828IPR002100Transcription factor, MADS-box
PfamPF003193.9E-241662IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-192843IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-194364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MDRKGKGRQK VEMVKMSNET NLQVTFSKRR AGLFKKASEL STLCDVDISM IVFSPGKKAF  60
SFGHPCVEKV IEYFICGNPP RDTSGAMMLI EAHRNSRIHE LNMILTQV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-17792186Myocyte-specific enhancer factor 2A
3kov_B1e-17792186Myocyte-specific enhancer factor 2A
3kov_I1e-17792186Myocyte-specific enhancer factor 2A
3kov_J1e-17792186Myocyte-specific enhancer factor 2A
3p57_A1e-17792186Myocyte-specific enhancer factor 2A
3p57_B1e-17792186Myocyte-specific enhancer factor 2A
3p57_C1e-17792186Myocyte-specific enhancer factor 2A
3p57_D1e-17792186Myocyte-specific enhancer factor 2A
3p57_I1e-17792186Myocyte-specific enhancer factor 2A
3p57_J1e-17792186Myocyte-specific enhancer factor 2A
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_347.10
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2385901e-154AC238590.1 Carica papaya BAC clone 12I03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021912039.12e-76agamous-like MADS-box protein AGL62
SwissprotQ9FKK24e-40AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLB9IJA62e-48B9IJA6_POPTR; Uncharacterized protein
STRINGevm.model.supercontig_347.106e-76(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-42AGAMOUS-like 62
Publications ? help Back to Top
  1. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]
  2. Figueiredo DD,Batista RA,Roszak PJ,Köhler C
    Auxin production couples endosperm development to fertilization.
    Nat Plants, 2015. 1: p. 15184
    [PMID:27251719]
  3. Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C
    Auxin production in the endosperm drives seed coat development in Arabidopsis.
    Elife, 2017.
    [PMID:27848912]
  4. Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
    Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal.
    Plant Signal Behav, 2017. 12(8): p. e1339000
    [PMID:28613109]
  5. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]