PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_3367.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family BES1
Protein Properties Length: 270aa    MW: 28700.5 Da    PI: 9.6969
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_3367.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF82256.11.6e-17234133
                        DUF822  1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGL 33
                                  ++++r+ptwkErEnnkrRERrRRaiaakiyaGL
  evm.model.supercontig_3367.1  2 TSGTRMPTWKERENNKRRERRRRAIAAKIYAGL 34
                                  5899****************************9 PP

2DUF82270.17.5e-223612359150
                        DUF822  59 GwvvedDGttyrkgskpleeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasa....as 135
                                   Gw+ve+DGttyrkg+kp e+++++g s+sasp+ss+q        +sp++sy++sp+sssfpsp  + + ++a+     +s
  evm.model.supercontig_3367.1  36 GWTVEEDGTTYRKGCKPVERMDIMGGSTSASPCSSYQ--------PSPCASYNPSPASSSFPSPRASPFPPTANGhadaSS 108
                                   9************************************........9******************9999888776677779* PP

                        DUF822 136 llpvlsvlslvsssl 150
                                   l+p+l++ls+ sss+
  evm.model.supercontig_3367.1 109 LIPWLKNLSSGSSSA 123
                                   ********9977664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.2E-13334IPR008540BES1/BZR1 plant transcription factor, N-terminal
PfamPF056871.6E-2336117IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MTSGTRMPTW KERENNKRRE RRRRAIAAKI YAGLPGWTVE EDGTTYRKGC KPVERMDIMG  60
GSTSASPCSS YQPSPCASYN PSPASSSFPS PRASPFPPTA NGHADASSLI PWLKNLSSGS  120
SSASSKLPNN FYIHSGSISA PVTPPLSSPT SRTPRTKNDW DDPSSGSAWA RQNYAFLPSS  180
TPPSPGRQVL PDSAWFAGIQ ISQSRPSSPT FSLVSRNPFG FREEALSGGG SRMWTPGQSG  240
TCSPAVPAGI DDNGDVPMSD GIAAEFAFGX
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009352718.11e-131PREDICTED: BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV883e-93BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A067GE961e-128A0A067GE96_CITSI; Uncharacterized protein
TrEMBLV4W9571e-128V4W957_9R
STRINGPOPTR_0004s06100.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP15951542
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.14e-63BES1/BZR1 homolog 4