PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_318.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 345aa    MW: 38164.8 Da    PI: 7.4339
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_318.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.93e-402686262
                       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                 +e+alkcprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+ s
  evm.model.supercontig_318.1 26 PEQALKCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRPS 86
                                 7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.6E-342884IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-272984IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6463084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
EMGSQSLENM LVCSKSQQER KPRPQPEQAL KCPRCDSTNT KFCYYNNYSL SQPRYFCKSC  60
RRYWTKGGTL RNVPVGGGCR KNKRPSSSSS SSASSASSKS RTHIDQLQPL TPNNINPSSL  120
ITSLPAALGY DDHHNHSNDL SLAFARLQKQ AIGQLGFDHD HHHHHPHPHQ HQQQLSILGN  180
LGNPDGILGN LGINAPASEH PGVFLTGFLG SQNPNLQNSY YGFGNGNTED HQMENNNPSN  240
GVAGHGDHHH HHQMVFPYDR EMTNATTTAV TVTTMKQEFC NGRDHDDHDQ INGNRSSQVL  300
WGFPWQINGD SNMGSAHHDL DNPGRESWTG LNSSWHGLLN SPLM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_318.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021912192.10.0dof zinc finger protein DOF2.1-like
TrEMBLA0A0K8K6351e-113A0A0K8K635_CAJCA; Dof protein
TrEMBLA0A151TN621e-114A0A151TN62_CAJCA; Dof zinc finger protein DOF2.1 (Fragment)
STRINGevm.model.supercontig_318.10.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69602743
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.12e-49Dof family protein