PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_3143.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HD-ZIP
Protein Properties Length: 395aa    MW: 43520.7 Da    PI: 5.4514
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_3143.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.81.6e-17223277256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  evm.model.supercontig_3143.1 223 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 277
                                   778899***********************************************98 PP

2HD-ZIP_I/II127.65.5e-41223313192
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+
  evm.model.supercontig_3143.1 223 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQ 303
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreelk 92 
                                   ke +eLr +lk
  evm.model.supercontig_3143.1 304 KELQELR-ALK 313
                                   ******9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-17208273IPR009057Homeodomain-like
SuperFamilySSF466891.5E-18210280IPR009057Homeodomain-like
PROSITE profilePS5007117.216219279IPR001356Homeobox domain
SMARTSM003897.3E-16221283IPR001356Homeobox domain
CDDcd000867.90E-16223280No hitNo description
PfamPF000465.4E-15223277IPR001356Homeobox domain
PROSITE patternPS000270254277IPR017970Homeobox, conserved site
PfamPF021838.4E-11279313IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.6E-26279322IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MELGLSLGET AKPAALGFMD RADHQKDLGF CMGLSIGSTT TTSPPPSPPQ QHQEDQRHED  60
GDDQADDDDD SIDQNDTTAP KKARRSTISE ALYGTDHHEP VQLDLLPNTP VLPFDPSSAN  120
GSSEADSPGR QMMVGCLRGF DVNRAPNNTN NNLIDQDQRN NNEDGAAVSS SPNSGSASSL  180
QIDFCIYSGG GGNLKDGHHH DQLDRSRASS RGGSDEDENG STRKKLRLSK EQSAFLEESF  240
KEHNTLNPKQ KLALAKQLNL RPRQVEVWFQ NRRARTKLKQ TEVDCEYLKR CCETLTEENR  300
RLQKELQELR ALKTSSPFYM QLPATTLTMC PSCERVATNN PTTDSSPSAA TFINRPSRLA  360
SANYPFPQPT STNTSIIPTS RDDHNNIHVK NIEN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1221227TRKKLRL
2271279RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_3143.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021912381.10.0homeobox-leucine zipper protein HOX11-like
SwissprotA2Z1U14e-84HOX11_ORYSI; Homeobox-leucine zipper protein HOX11
TrEMBLB9HPS01e-112B9HPS0_POPTR; Uncharacterized protein
STRINGevm.model.supercontig_3143.10.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49282852
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-67homeobox from Arabidopsis thaliana