PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_3.430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family MYB
Protein Properties Length: 1453aa    MW: 163465 Da    PI: 7.0005
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_3.430genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.53.6e-09468512246
                                  SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
              Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                  ++WT+eEd+ l++ ++  G  +W  Ia  +g++Rt+ qc  r+q 
  evm.model.supercontig_3.430 468 DPWTAEEDKNLLCIIQDKGITDWLDIAISLGTNRTPFQCLARYQR 512
                                  58*****************************************96 PP

2Myb_DNA-binding34.83.9e-11521558240
                                  SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
              Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40 
                                    WT++Ed+ l  av+++G ++W ++a+ +  gRt+ qc
  evm.model.supercontig_3.430 521 REWTEDEDDELRMAVEKFGEHNWQSVASLLK-GRTGPQC 558
                                  68****************************9.******* PP

3Myb_DNA-binding45.32.1e-14715758347
                                  SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
              Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   W ++Ed+ l+ av ++G+++Wk+I++ ++ gRt  qc++rw + 
  evm.model.supercontig_3.430 715 LWNQDEDKHLKVAVILFGPKNWKKISQFVP-GRTQVQCRERWVNC 758
                                  5*****************************.***********986 PP

4Myb_DNA-binding48.22.5e-15765807145
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
              Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                  +g WT+eEd +l  a++++G   W+++a++++  Rt++qc  rw 
  evm.model.supercontig_3.430 765 KGEWTKEEDSRLRAAIAEHGHC-WSKVAAHLP-SRTDNQCWRRWK 807
                                  799*****************99.*********.***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.044366463IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-8369385IPR009057Homeodomain-like
PROSITE profilePS500904.913369461IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.4E-8434474IPR009057Homeodomain-like
SuperFamilySSF466893.82E-14443514IPR009057Homeodomain-like
PROSITE profilePS5129411.136462518IPR017930Myb domain
SMARTSM007172.5E-8466516IPR001005SANT/Myb domain
CDDcd001676.61E-7469514No hitNo description
PfamPF002497.1E-8469512IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-12475524IPR009057Homeodomain-like
SuperFamilySSF466892.55E-15499560IPR009057Homeodomain-like
PROSITE profilePS512948.55519567IPR017930Myb domain
SMARTSM007173.1E-6519570IPR001005SANT/Myb domain
PfamPF002495.5E-10521558IPR001005SANT/Myb domain
CDDcd001678.54E-9522558No hitNo description
Gene3DG3DSA:1.10.10.603.9E-12525560IPR009057Homeodomain-like
SuperFamilySSF466893.14E-10698752IPR009057Homeodomain-like
PROSITE profilePS5129413.762707759IPR017930Myb domain
SMARTSM007173.6E-12712761IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-19714764IPR009057Homeodomain-like
PfamPF002494.5E-13715758IPR001005SANT/Myb domain
CDDcd001675.17E-11716757No hitNo description
SuperFamilySSF466893.34E-26739811IPR009057Homeodomain-like
PROSITE profilePS5129425.992760814IPR017930Myb domain
SMARTSM007172.3E-15764812IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-20765808IPR009057Homeodomain-like
PfamPF002499.7E-14765807IPR001005SANT/Myb domain
CDDcd001676.82E-12767809No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1453 aa     Download sequence    Send to blast
MSRNDDYDDE EGGDEDGEQF SDSDDDDGFK EDMEALRRAC MITGTNLDDH DGTAGEAPSN  60
SAIAGSGDEG CGVGDGVAWE SDGEEDIKLF RSIRERFALS EDVREPLSMK PLCILPPLPS  120
DDGDEEDFEI FRSIQRRFSA YEDSDTPKNY MEDLLRKPEQ VHASGITSEK GTSYDMFMNR  180
TNTCEGFPDN GQARDNIADS VATANIILDS KEACEPVHLR EDTAQPSTLA GRLQADACKS  240
ELPHSNSSFP ESAQVLIDAI RKNRAYQRFI RSKLTHIEAR IEENKKLKER FKILRDFQVS  300
CKRLTGKALS QKKDPRVQLI SAQRSRSADD CEVNDKKVSA MNSGPTENSH VANYRMALTK  360
FPLSFPCKKW SAEERKNLAK GIRQQFQEML LNVSMDRISA TEGSSGDSNN LDNILTSIKD  420
LKITPEMIRR FLPKVNWDNL ASMYVTGHSG SECETRWLNW EDPLINCDPW TAEEDKNLLC  480
IIQDKGITDW LDIAISLGTN RTPFQCLARY QRSLNACILK REWTEDEDDE LRMAVEKFGE  540
HNWQSVASLL KGRTGPQCSN SQFACSVWSA PWFLECQRRE ECHQLGHYWP LVTRSPAAQA  600
LRFKFVILTV SSAPPGAWSF FYLIYCLAPR LPAEPEWAQQ SAYVSGRMPL IVTAGSTATS  660
SIEYKRANDA IAMNIGMILG TMFLKKGPLN LRTSALFCPY RWKKSLHPTR LRVGLWNQDE  720
DKHLKVAVIL FGPKNWKKIS QFVPGRTQVQ CRERWVNCLD PSLNKGEWTK EEDSRLRAAI  780
AEHGHCWSKV AAHLPSRTDN QCWRRWKALN PDKVPLVQEA RRMRRTAFIC NFVDRESERP  840
KLDPKDFIPL AITDTPSETG NIMPSKRDGG NIMSSKKDRR KLRIVQIFTC GFYTSKAILV  900
TIMLTVSSFT EFSKITQKVQ SRRGRKRQRS ETQQVTGITG GRDVETLDGD RTIERNRRKN  960
LCLKQNRFSE AVGHHSSSFQ KDGAIQRKKT IKSCLKKNKS SETVQDHSSP DQVSTFFTSN  1020
NGGTNTTSEK RFIQTHSRKG KHVVPDTDSE TFVSLYPESV QSGIYGVEAS GENNPTSRRT  1080
KVPRRRRSRR RCAEMGEEVQ QAFNTVESDL DGDITLSHFM KNRLKKRRIN SNDLPNIISD  1140
KADDNARHFV ESTGGSMSMN LEHAHQTGNP TPVNNTAQDK EPTSRRTKVP CKRHSRRRCA  1200
EMDEEVQEAL NTLEGDLDGY ITLSHFMKNR SKKRRINASN DSPNIISEKA DENVRHFVGF  1260
TGESMSMNLE RAHQTENPIP VNITAQDKEP CRKDCGEDGI IATTEAVNTN LETDNEAGHI  1320
TLAPFMHNNT NLVTDNEAGH VTLASFMHSE RNRQGGIVSN DISMVLPADD ACGGDQMATE  1380
SLGTYPESAH AHESSDGPAV HVEISDKEPG RIDAAEGGSV GGSDAAHVNL EDNSVAEDFK  1440
LAHLVRKRLK RR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-194458124118MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
114451451RKRLKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU4312249e-84EU431224.1 Carica papaya mitochondrion, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007036689.10.0Myb domain protein 4r1, putative isoform 1
TrEMBLA0A061FUM30.0A0A061FUM3_THECC; Myb domain protein 4r1, putative isoform 1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP73551617
MalvidsOGEM65042744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-140myb domain protein 4r1