PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_3.229
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 341aa    MW: 35996.5 Da    PI: 7.5253
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_3.229genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.6e-393191262
                       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                 +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+++
  evm.model.supercontig_3.229 31 NHQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKAKRAK 91
                                 57899****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-282989IPR003851Zinc finger, Dof-type
PfamPF027012.0E-333389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5063589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MQDIHAIGGG GRLFGGGGGD RRLRPHSHHQ NHQALKCPRC DSLNTKFCYY NNYNLSQPRH  60
FCKSCRRYWT KGGVLRNVPV GGGCRKAKRA KSKPSNPDSS AAAAATVTAA TTTMTSSQQH  120
RDRKASSHSS SESSSLTAAN SNAIVATAST KAGAVALTSA AATAEVSGHS SGSVSNLLNV  180
NDTKFYGHAN ANCGFESGTL LPEQGSDCGI FSEIGSFTSL ITSSSNETMS FGFGNMLSQA  240
QGLDQNPEQW QNQEQQKMVN MGSGGEELKM QEITGGGLLD QTVQLELSAL QGRSGNGGFG  300
SLDWQAGGDQ GLFDLPNAVD QAYWSQGQWT DQDQPSLYLP *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1917GGRLFGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_3.229
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021909600.10.0dof zinc finger protein DOF5.4
TrEMBLA0A2C9UL961e-116A0A2C9UL96_MANES; Uncharacterized protein
STRINGevm.model.supercontig_3.2290.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44822656
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-38OBF binding protein 4