PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_3.115
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 291aa    MW: 31506.7 Da    PI: 8.0222
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_3.115genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.3e-3940101263
                       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                                  k++al+cprC s+ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rk k+sss
  evm.model.supercontig_3.115  40 KDQALNCPRCSSNNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKTKRSSS 101
                                  57999*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-253392IPR003851Zinc finger, Dof-type
PfamPF027012.4E-334198IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9014498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MESGTAQWPQ GIGVVKTMST ESTCSRSPPL LDRKTCRPLK DQALNCPRCS SNNTKFCYYN  60
NYSLSQPRYF CKTCRRYWTE GGSLRNVPVG GGSRKTKRSS SSSPSTPLSS STKLNSTTTT  120
THQNPNKIHG SQELNLAYPP PDHHDYSTFV DDHHLHQNPT NSSPMELFKT EIITSRNLSS  180
FMAIPTTTTT TSSSPHHDSV YSSGLTLQEL NKPTLSFSLD GLEGCLQLQG GGVQESGARL  240
LFPMDQGTKQ ADPIQIQFEN NHNNRGDDDG STGGFWGSGM LGGGGGGGSW *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1277288SGMLGGGGGGGS
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_3.115
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021909448.10.0dof zinc finger protein DOF1.8-like
TrEMBLA0A061G2L65e-75A0A061G2L6_THECC; F-box family protein, putative isoform 1
TrEMBLA0A438BU517e-75A0A438BU51_VITVI; Dof zinc finger protein DOF4.6
TrEMBLF6H7D07e-75F6H7D0_VITVI; Uncharacterized protein
STRINGevm.model.supercontig_3.1150.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1964367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.12e-34Dof family protein