PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_27.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family SBP
Protein Properties Length: 146aa    MW: 16451.1 Da    PI: 6.9849
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_27.40genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.13.4e-4060137178
                                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                  +Cq+++C++d+ +ak+y++rhkvCe h+ka+ vlv+g++qrfCqqCsrfhe+sefD++krsCrrrLa+hnerrrk+++
  evm.model.supercontig_27.40  60 CCQADHCTVDMGDAKRYYKRHKVCEYHAKASFVLVNGVQQRFCQQCSRFHEVSEFDDTKRSCRRRLAGHNERRRKSST 137
                                  6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375751.9E-571145IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.0E-3155122IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.9458135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.67E-3859140IPR004333Transcription factor, SBP-box
PfamPF031107.4E-3261134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MGTSRAEGKR SLKEIEEDEE EEEDDDCTGG LGFEEEEKKK KKGRRGSSAA EAAGASMLPC  60
CQADHCTVDM GDAKRYYKRH KVCEYHAKAS FVLVNGVQQR FCQQCSRFHE VSEFDDTKRS  120
CRRRLAGHNE RRRKSSTDYI GDGSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3652134284squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027797.11e-57PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
SwissprotQ387412e-44SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A061GEC86e-56A0A061GEC8_THECC; Squamosa promoter-binding-like protein
STRINGPOPTR_0004s04630.16e-52(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.19e-41squamosa promoter binding protein-like 5