PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_264.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family CPP
Protein Properties Length: 430aa    MW: 46964.5 Da    PI: 8.1809
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_264.4genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.67.7e-16152190240
                          TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                  ++k+CnC++skClk+YCeCfaag +C e C+C+dC+Nk 
  evm.model.supercontig_264.4 152 TCKRCNCRRSKCLKLYCECFAAGLYCIEPCSCQDCFNKP 190
                                  689**********************************96 PP

2TCR52.88e-17235274140
                          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                  ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+C+N+ 
  evm.model.supercontig_264.4 235 RHKRGCNCKKSSCLKKYCECFQGGVGCSISCRCEGCRNTF 274
                                  589***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.2E-17151192IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.115152275IPR005172CRC domain
PfamPF036382.3E-11154189IPR005172CRC domain
SMARTSM011141.1E-17235276IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.3E-12237273IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MRRRCLLFEM AAANRKKPIC ESQGSSSTSL SSSSEVSLTE KQLDLSNRSI SKSSIYSGIG  60
LHLNALATTP TDGKAVKSQT LASGVKIISI PGCLPSSDSS RTSSSKERDL VISDGEATEN  120
ASNTHIDAGG EEFENENSKR KRCQILNGGG ETCKRCNCRR SKCLKLYCEC FAAGLYCIEP  180
CSCQDCFNKP IHEDTVLETR RQIESRNPLA FAPKVIRNTD ASEVGDENKT PASARHKRGC  240
NCKKSSCLKK YCECFQGGVG CSISCRCEGC RNTFGQKDGS DQPEVNEEDS EELERSISEL  300
DSHDSLVKKN EEYPYSVHSS EIVRGKRPVH PGSEVGPPSR LRARSRLGTP DLFQQQPKFE  360
SNLQAIPENG TSDGNLHASS TAVNYTSPNS KRVSVSPPHH QELRASISQN GTRKLILRCT  420
PLFSSRLQP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1615427212120Protein lin-54 homolog
5fd3_B1e-1615427212120Protein lin-54 homolog
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_264.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021912476.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A438GP591e-121A0A438GP59_VITVI; CRC domain-containing protein TSO1
STRINGevm.model.supercontig_264.40.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Representative plantOGRP9931755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.13e-87TESMIN/TSO1-like CXC 2