PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_25.93
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 179aa    MW: 19725.5 Da    PI: 10.2854
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_25.93genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.33.6e-221057249
                                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                                  ++++s rqvtfskRr+g++KKA+EL +LC+aev v++fs+ gk y +
  evm.model.supercontig_25.93 10 VVKDSSSRQVTFSKRRTGLFKKANELVTLCGAEVVVVVFSPGGKPYSF 57
                                 5789***************************************98877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.604161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.23E-28172IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-34160IPR002100Transcription factor, MADS-box
CDDcd002658.77E-32272No hitNo description
PRINTSPR004041.7E-19323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-251257IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MGRRKIEMKV VKDSSSRQVT FSKRRTGLFK KANELVTLCG AEVVVVVFSP GGKPYSFGHP  60
SVDTITRRFL DNDTSATTDV SNDGGIEKLN RQLNDLNRQI AAEKKRGDML EKSLRESGAT  120
QFMKSVSKVN KMDELVYLKA LANNVRGNVI ERINELEASD ALLLLSNTIP ANHDNGKL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_25.93
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021903019.11e-128agamous-like MADS-box protein AGL29
TrEMBLA0A061GKZ37e-60A0A061GKZ3_THECC; Agamous-like MADS-box protein A, putative
STRINGevm.model.supercontig_25.931e-127(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.17e-43AGAMOUS-like 29