PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_25.27
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family MIKC_MADS
Protein Properties Length: 258aa    MW: 29177.2 Da    PI: 6.2887
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_25.27genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.44.4e-141866250
                                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                 +i n+  r+ ++ kR +++  KA+ LS+L d+ v+v+ f+++gkl++++
  evm.model.supercontig_25.27 18 FIANNNARNASWKKRIQTLKLKAHQLSTLADVSVSVLCFAPDGKLHTWP 66
                                 799*********************************************8 PP

2K-box15.95.2e-071291644176
                        K-box  41 edLesLslkeLqqLeqqLekslkkiRskKnellleq 76 
                                  ++L++L   eL++L  +L+  l++ R+++++lll++
  evm.model.supercontig_25.27 129 QSLDELPKSELMNLMGRLDFTLQRLRERRDQLLLDK 164
                                  689******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006611.704969IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-4968IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-151189IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-51131IPR002100Transcription factor, MADS-box
PfamPF003194.2E-121865IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-53146IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-54667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
METSIPNPTN KRNRSLQFIA NNNARNASWK KRIQTLKLKA HQLSTLADVS VSVLCFAPDG  60
KLHTWPENPT EVKQIVMNYK NCVDRDARQG KWSENVDLSS FLETKKRKIQ EEKSEIDGAK  120
EAESCTSEQS LDELPKSELM NLMGRLDFTL QRLRERRDQL LLDKNNVPLP SDNFAVPGFN  180
DNVGSLQGFG SENQKINNGG SSNFLPGYEM FDYQSMLIPQ FQVVPDHQLM LIPPFQVVCS  240
DLAMLMPSFQ EALPLSR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_25.27
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021903044.10.0floral homeotic protein AGAMOUS-like
TrEMBLA0A4D6D2571e-134A0A4D6D257_CARPA; Floral homeotic protein
STRINGevm.model.supercontig_25.270.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1213926
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.12e-12AGAMOUS-like 103