PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_2423.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 126aa    MW: 14278.1 Da    PI: 9.9715
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_2423.4genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.94.6e-171963145
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                                  k+ en+   qvtfsk r  ++KKA+EL++LC  +v +i+fs++++
  evm.model.supercontig_2423.4 19 KKMENEASLQVTFSKHRSSLFKKASELCTLCRPDVGLIVFSPRNR 63
                                  56799999**********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.0111171IPR002100Transcription factor, MADS-box
SMARTSM004325.4E-211170IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.15E-211285IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-151333IPR002100Transcription factor, MADS-box
PfamPF003198.3E-192064IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-153348IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-154869IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MADEETSSKN KGRQKIESKK MENEASLQVT FSKHRSSLFK KASELCTLCR PDVGLIVFSP  60
RNRALCYGNP NIDIVIDHFL NIDVRPARDP DNDNDTQQTI SKIRLKTRRR QQGSEVKSSN  120
KEEKA*
Functional Description ? help Back to Top
Source Description