PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_235.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 272aa    MW: 29504 Da    PI: 11.229
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_235.6genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.31e-18204233332
                         GATA   3 nCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
                                   C tt+Tp+WRrgp g+ktLCnaCG++yrk
  evm.model.supercontig_235.6 204 KCSTTETPMWRRGPLGPKTLCNACGIKYRK 233
                                  7****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.8E-14194254IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.98E-13194250No hitNo description
PROSITE profilePS5011412.334194252IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.5E-14196245IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.06E-14199233No hitNo description
PfamPF003202.1E-16204234IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MPAMTNQGPL GPNRMPAMVN QVPLGPNRMP AVMNQVPLEP NRMPAVMNQV PLEPNRMPAV  60
MNQGTNRMPG MVNQGPLGPN RMPAMMNQVP LGPNRIHGGT NVIPTSEWIA QANAQRAAAA  120
GNTMPYQFGP PQHPAAVLPA PSVAPMLFPT TAQPYTSNPL VLQPADSTAP ILNQVVLIDV  180
PPRRAQRARD CFASNGGRRC SNFKCSTTET PMWRRGPLGP KTLCNACGIK YRKDVEKKKV  240
RDAERILELH RRNNQQGSSS NANDEASQRF A*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_235.6
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGevm.model.supercontig_235.60.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM106522234
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20750.13e-20GATA transcription factor 29