PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_231.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 82aa    MW: 9564.13 Da    PI: 10.3646
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_231.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF626.9e-20858151
                                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                 k+ien+s+ +vtf+kRrn ++KK +E+Sv C+++v+ + fs++g++  y+s
  evm.model.supercontig_231.1  8 KKIENSSKCHVTFTKRRNSLIKKSYEISVYCGVDVLFLTFSPSGRVTHYCS 58
                                 78**********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.381160IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-19159IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-15222IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-23377IPR002100Transcription factor, MADS-box
PfamPF003191.7E-19956IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-152237IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-153758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
MGRKIDLKKI ENSSKCHVTF TKRRNSLIKK SYEISVYCGV DVLFLTFSPS GRVTHYCSRQ  60
RMEDVLQRYI NMPSDKKHHL N*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_231.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021912761.17e-51agamous-like MADS-box protein AGL66
TrEMBLA0A2G9HAZ82e-31A0A2G9HAZ8_9LAMI; Uncharacterized protein
STRINGevm.model.supercontig_231.14e-54(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.11e-23AGAMOUS-like 104