PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_21.195
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Trihelix
Protein Properties Length: 469aa    MW: 52819.4 Da    PI: 5.5506
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_21.195genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix47.64.4e-1544131170
                      trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkm..................rergf.erspkqCkekwenlnkryk 62 
                                   rW++qe+laL+++r++m+ ++r+++lk+plWeevs+                      + f ers+++ k kw++  kr  
  evm.model.supercontig_21.195  44 RWPRQETLALLKIRSDMDATFRDSSLKGPLWEEVSSTFvnvssnlfssstssstasD-EEFeERSSNRRKRKWKEFFKRLT 123
                                   8***********************************999****************63.44436777777777776666655 PP

                      trihelix  63 kikegekk 70 
                                   k+  ++++
  evm.model.supercontig_21.195 124 KEVIHKQE 131
                                   55444333 PP

2trihelix108.35.1e-34272357187
                      trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpy 81 
                                   rW+k ev+aLi++r++++++++++  k+plWee+s+ m++ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpy
  evm.model.supercontig_21.195 272 RWPKAEVQALIKLRTSLDTKYQENGPKGPLWEEISAGMKRLGYNRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPY 351
                                   8*********************************************************************8.99******* PP

                      trihelix  82 fdqlea 87 
                                   f+ql+a
  evm.model.supercontig_21.195 352 FHQLDA 357
                                   ****85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174141121IPR001005SANT/Myb domain
PROSITE profilePS500905.18143119IPR017877Myb-like domain
SMARTSM007171.1E-4269331IPR001005SANT/Myb domain
CDDcd122033.74E-28271336No hitNo description
PROSITE profilePS500907.526271329IPR017877Myb-like domain
PfamPF138371.2E-23272358No hitNo description
Gene3DG3DSA:1.10.10.602.1E-4272328IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MVGDQSSLLP NSGDAAGTHE ASSEVGGQED NTNQGGDRGF GGNRWPRQET LALLKIRSDM  60
DATFRDSSLK GPLWEEVSST FVNVSSNLFS SSTSSSTASD EEFEERSSNR RKRKWKEFFK  120
RLTKEVIHKQ EDLQKKFLDA LEKREHERMA REEAWRIQEM ARINREHEIL VKERSTAAAK  180
DAAVISFLQK ISSQQIPVQV PGNPNPNPNP SALPPPQPPP PIQEHLRHQQ QQHYHLQQVP  240
LAPVTNMEIV PRLDNGDNNI SVINVAVPSP SRWPKAEVQA LIKLRTSLDT KYQENGPKGP  300
LWEEISAGMK RLGYNRSSKR CKEKWENINK YFKKVKESNK KRPEDSKTCP YFHQLDALYR  360
EKNGNNINKN ETAPAGNITS VNYNNNNGNN IPAAAPLMVH PEQQWPLQMQ HQQVQPQSME  420
DLERESAEHE EEDEEVGSEE EGDDDEEGGG FELVANKSSS VTSMAAGE*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_21.195
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021903521.10.0trihelix transcription factor GT-2-like
SwissprotQ391176e-91TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A2H4NFX11e-108A0A2H4NFX1_FRAAN; Trihelix transcription factor GT-2B
STRINGevm.model.supercontig_21.1950.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48492553
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.15e-90Trihelix family protein