PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_21.194
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Trihelix
Protein Properties Length: 642aa    MW: 71154.6 Da    PI: 6.5282
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_21.194genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix90.51.8e-2870154187
                      trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpy 81 
                                   rW++qe+ aL+++r+em+ ++r+++ k+plWeevs+k++e g++r++k+Ckek+en+ k++k++keg+ ++  ++ +t+++
  evm.model.supercontig_21.194  70 RWPRQETIALLKIRSEMDVAFRDASVKGPLWEEVSRKLAELGYNRNAKKCKEKFENVYKYHKRTKEGRTGK--PEGKTYRF 148
                                   8********************************************************************95..55568*** PP

                      trihelix  82 fdqlea 87 
                                   fdqlea
  evm.model.supercontig_21.194 149 FDQLEA 154
                                   ****85 PP

2trihelix102.63.1e-32457542187
                      trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpy 81 
                                   rW+k ev aLi++r+e++ +++++  k+plWee+s+ m++ g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpy
  evm.model.supercontig_21.194 457 RWPKVEVEALIRLRTELDCKYQENGPKGPLWEEISAGMKKLGYNRNAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPY 536
                                   8*********************************************************************8.99******* PP

                      trihelix  82 fdqlea 87 
                                   f+ql+a
  evm.model.supercontig_21.194 537 FHQLDA 542
                                   ****85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.005867129IPR001005SANT/Myb domain
CDDcd122035.27E-2569134No hitNo description
PROSITE profilePS500906.99269127IPR017877Myb-like domain
PfamPF138379.2E-1969155No hitNo description
SMARTSM007170.0055454516IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-4456513IPR009057Homeodomain-like
CDDcd122034.36E-28456521No hitNo description
PROSITE profilePS500907.282456514IPR017877Myb-like domain
PfamPF138371.1E-22456543No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MLQGGVGNAA AAPSVFGSSG DGGGSSTTSG AHEGSSEAGG GGGVLVGQVS EEDKGIRIGD  60
DGDRGFGVNR WPRQETIALL KIRSEMDVAF RDASVKGPLW EEVSRKLAEL GYNRNAKKCK  120
EKFENVYKYH KRTKEGRTGK PEGKTYRFFD QLEALDTQPP PRILPQQQQQ PRPQSTVMAA  180
MAMQTAVNNI PATITHGTVP STTTTLPTMS QTVVAAPTIN LAPADPTVVQ SVPAQAPVAA  240
AAAATTNPAG NPLTTSTPMS FANISMELLS NSTSSSTSSD VELGGRRKRK RKWKDFFEGL  300
MQEVIDKQEQ LHRRFMEALE KREQERLIRE EAWRVQEMAR INREREILAQ ERAITAEKDA  360
AVMAFLQKLS ERQTPSNQPV HNINTPQPQP QPQPQPQSQP PSQPEPQPLP ARPPVQPVLL  420
PPPLPETSVV QAPVMNVMET QKADNGNQTF SPASSSRWPK VEVEALIRLR TELDCKYQEN  480
GPKGPLWEEI SAGMKKLGYN RNAKRCKEKW ENINKYFKKV KESNKKRPED SKTCPYFHQL  540
DALYRQKNRL DHGSSAINQI KPENSVPLMV RPEQQWPPPP HPHHQQRPDH HSIMDDTNSE  600
QMDHVHDDDD KDGDEEEEEE DEEGGSYEIV PNKAVSVGSS E*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1285290RRKRKR
2285291RRKRKRK
3286291RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_21.194
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021903431.10.0trihelix transcription factor GT-2-like
TrEMBLA0A067H7R90.0A0A067H7R9_CITSI; Uncharacterized protein
STRINGevm.model.supercontig_21.1940.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48492553
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.24e-74Trihelix family protein